PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00318g14016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family BES1
Protein Properties Length: 320aa    MW: 34428.4 Da    PI: 8.8926
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00318g14016.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822218.21.9e-67231512130
                    DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssa 86 
                               +++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+++++ +e++g+sa
  Peinf101Scf00318g14016.1  23 SGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGCSRPTPMEIGGTSA 107
                               799********************************************************************************** PP

                    DUF822  87 saspesslqsslkssalaspvesysaspksssfpspssldsisl 130
                               +++p+ss + s+ ss++asp++sy++sp+sssfpsps++d +++
  Peinf101Scf00318g14016.1 108 NITPSSSRNPSPPSSYFASPIPSYQPSPTSSSFPSPSRVDANMS 151
                               ****************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.9E-6223152IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MMWEGGGEDG GGGVGGGGGG SSSGRRKPSW RERENNRRRE RRRRAIAAKI YAGLRAQGNY  60
NLPKHCDNNE VLKALCAEAG WIVEPDGTTY RKGCSRPTPM EIGGTSANIT PSSSRNPSPP  120
SSYFASPIPS YQPSPTSSSF PSPSRVDANM SPFAFLHNTI PSSLPPLRIS NSAPVTPPLS  180
SPTRLPKQTF NLETLARESM SAFNIPFFAA SAPTSPTRGQ RFTPATIPEC DESDTSTIDS  240
GQWMSFQKYA ANGVPTSPTF NLIKPAAQRI PSNDMIIDKG KSIEFDFENV SVKAAWEGEK  300
IHEVGLDDLE LTLGGGSSRM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12443RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2474440.0KP247444.1 Nicotiana benthamiana BES1/BZR1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009781919.11e-179PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
RefseqXP_016470141.11e-179PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-113BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A0F6VYB21e-173A0A0F6VYB2_NICBE; BES1/BZR1
STRINGSolyc04g079980.2.11e-171(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.26e-93BES1 family protein